########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

Cut190

Saccharomonospora viridis · 304 aa · UniProt

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 304 aa

catalytic triad  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MRIRRQAGTGARASMARAIGVMTTALAVLVGAVGGVAGAEVSTAQDNPYERGPDPTEDSIEAIRGPFSVATERVSSFASGFGGGTIYYPRETDEGTFGAVAVAPGFTASQGSMSWYGERVASQGFIVFTIDTNTRLDQPGQRGRQLLAALDYLVERSDRKVRERLDPNRLAVMGH176SMGGGGSLEATVMRPSLKASIPLTPWNLDKTWGQVQVPTFIIGAEL222DTIASVRTHAKPFYESLPSSLPKAYMELDGAT254HFAPNIPNTTIAKYVISWLKRFVDEDTRYSQFLCPNPTDRAIEEYRSTCPY

Activity

Optimum temperaturenot recorded
Optimum pHnot recorded
Familycutinase

Structure

Source Experimental, PDB 4WFI
Resolution1.45 Å
Residues258
Cα RMSD to IsPETase1.89 Å

Active site

Catalytic triadSer176 · His254 · Asp222
Ser OG → His NE22.70 Å
His ND1 → Asp OD3.12 Å
Oxyanion donor 1177 (3.10 Å)
Cleft width16.60 Å
Cleft depth4.05 Å
Cleft residues82

Aromatic clamp: PHE106 · PHE234 · PHE255 · TRP201

Measured activity

No measurement rows. The enzyme is in the reference set on the strength of its curation source rather than a value extracted into this database.

Related in PANTS

Lineage

Variants built on this enzyme:
Cut190**SS

Nearest metagenomic candidates

1 candidate in the catalogue have this as their nearest characterised enzyme.

5ee40d6243c4

Superpose the top four →

Identifiers and cross-references

Saccharomonospora viridis AHK190 cutinase, 304 aa. STRAIN AMBIGUITY RESOLVED 2026-08-05: UniProt carries two 304 aa entries for this organism, W0TJ64 and C7MVE8 (type strain P101), and length alone cannot separate them. The Cut190 crystal structures settle it: 4WFI, 4WFJ, 4WFK, 5ZNO, 5ZRQ and 5ZRR all cross-reference W0TJ64, and C7MVE8 has no PDB entry at all. Structural evidence over a name match.