########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

HGMP01

Clostridia: Acutalibacteraceae · 275 aa · HGMP-measured

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 275 aa

catalytic triad  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MLKKTLAMLLALVMMLSICCTTAFAASEQSTKNITNVTTESDVSVYRDLMLVAGKYVFYPADFETTTKKYPVVTWANGSWCPIQTYLPIIYGLVKAGYIVVADTDLLTDDGKSTVDSVSYIIKQNKNKNSMFYKRINTKQIGSTGH147SLGGQAAVNASAKDSRIKAIVSLAGKSVADEAAKVTVPALYLSGTL193DMIVPSKDYVYPSYKASKGPAAYASFNNMV223HFGVWIAPGNYVKYTVAWFDVYLKGDKSKLSMFKKGGDLSTDDFWINYESKNL

Activity

Optimum temperature40.0 °C
As publishedOptimum temperature 40 degC on PET nanoparticles. Broad tolerance across pH 7.x Assay: 0.5 mg/mL PET nanoparticles in 200 uL, 50 mM sodium phosphate (pH 6-8) or glycine-NaOH (pH 9-11), 25-45 degC, 24 h
Optimum pHnot recorded
Familypetase_like

Structure

Source ESMFold prediction
Mean pLDDT89.3
Residues275
Cα RMSD to IsPETase11.16 Å

Active site

Catalytic triadSer147 · His223 · Asp193
Ser OG → His NE22.93 Å
His ND1 → Asp OD2.96 Å
Oxyanion donor 1148 (2.95 Å)
Oxyanion donor 279 (4.52 Å)
Cleft width23.72 Å
Cleft depth3.66 Å
Cleft residues86

Aromatic clamp: PHE218 · PHE224 · TRP227 · TRP75 · TRP80 · TYR187 · TYR201 · TYR203 · TYR233 · TYR86

Measured activity

ParameterValueSubstrateEvidenceSource
ordinal activity PET nanoparticle measured PMID 39551294 · 10.1016/j.ijbiomac.2024.137732
surpassed all other candidates on PET nanoparticles. Assay: 0.5 mg/mL PET nanoparticles in 200 uL, 50 mM sodium phosphate (pH 6-8) or glycine-NaOH (pH 9-11), 25-45 degC, 24 h.
topt 40.0 degC PET nanoparticle measured PMID 39551294 · 10.1016/j.ijbiomac.2024.137732
Optimum temperature 40 degC on PET nanoparticles. Broad tolerance across pH 7.x Assay: 0.5 mg/mL PET nanoparticles in 200 uL, 50 mM sodium phosphate (pH 6-8) or glycine-NaOH (pH 9-11), 25-45 degC, 24 h

Related in PANTS

Lineage

No recorded parent or derived variants.

Nearest metagenomic candidates

3 candidates in the catalogue have this as their nearest characterised enzyme.

5a8208b2421ac40aa8377f273b50eab19302

Superpose the top four →

Identifiers and cross-references

Human gut PET hydrolase, measured. The active one: hydrolyses PET nanoparticles and outperformed all other candidates. Shares only ~5% identity with IsPETase. Optimum 40 degC at near-neutral pH, which is the closest to physiological conditions of any measured PET hydrolase in this project. Deposit id GUT_GENOME238302_00589 (the paper's HGMP01 is HGMP03 in the supplementary). 697 homologues in UHGP-100. DLH domain: yes. PMID 39551294.