########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

HGMP03

Bacteroidia: Porphyromonadaceae · 323 aa · HGMP-measured

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 323 aa

catalytic triad  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MRPNIITTLLLFTLLIIGGSRPLYGQELQENWWSNGKYAIEDVADPVYSFDEEYMKDVPNIYLPIGKTGKLPVVIVVHGWAAYKEQMHDTAQLLASHGMLVLVYTAMDQNQPFQWLDGIIAAYTLLEGENRRPGSKIHNRVDFQRIGLLGH152SMGGTGVLFSAAMEKPNGLRGKIKTVVSLMPYHGTTNFISDAVAGGKDKLGCDVSATPNATLIISGEV220DEVNEPIGGYEFYQTLTQNKRVFFSMKGTH250HNDWRNKEGKESENYPIVMPVVSSWMLAYLCGERQYESFFKEGGLYFEKWIRPTLKGNVKVGRGEFPAFEIKEP

Activity

Optimum temperaturenot recorded
Optimum pHnot recorded
Familypetase_like

Structure

Source ESMFold prediction
Mean pLDDT79.7
Residues323
Cα RMSD to IsPETase9.50 Å

Active site

Catalytic triadSer152 · His250 · Asp220
Ser OG → His NE22.89 Å
His ND1 → Asp OD2.99 Å
Oxyanion donor 1153 (2.89 Å)
Oxyanion donor 280 (4.51 Å)
Cleft width23.31 Å
Cleft depth3.61 Å
Cleft residues81

Aromatic clamp: PHE113 · PHE160 · PHE189 · PHE231 · TRP115 · TRP253 · TRP80 · TYR104 · TYR183 · TYR229 · TYR83

Measured activity

ParameterValueSubstrateEvidenceSource
ordinal activity PET nanoparticle measured PMID 39551294 · 10.1016/j.ijbiomac.2024.137732
below HGMP01; not ranked against the other three. Assay: 0.5 mg/mL PET nanoparticles in 200 uL, 50 mM sodium phosphate (pH 6-8) or glycine-NaOH (pH 9-11), 25-45 degC, 24 h.

Related in PANTS

Lineage

No recorded parent or derived variants.

Nearest metagenomic candidates

No candidate in the catalogue names this enzyme as its nearest match.

Identifiers and cross-references

Human gut PET hydrolase, measured. Deposit id GUT_GENOME137663_00143 (the paper's HGMP03 is HGMP06 in the supplementary). 96 homologues in UHGP-100. DLH domain: no. PMID 39551294.