########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

HGMP05

Bacteroidia: Porphyromonadaceae · 320 aa · HGMP-measured

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 320 aa

catalytic triad  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MRHNIIVTLLLGTLLTLRGLTPLYGQELQEDWWRTGKYAIEDIADPVYSLDEEYMRDTPNLYLPKGKTGKLPVVIVIHGWGGTKEQMQPTAQLLASHGMLVLNYTAVDQNQPFQWLDGLVAAYTLLEGENRRPGSKIYNRVDFQRIGLLGH152SMGAAGVLHIAAMEKPNGLRGKIKTVVSMMPYHGTTSTFTDNIAGGKDKLGCDISSTPNATLIISAEL220DPTNEPIGGYEFYQTLKRNKRVFFSLKGAK250HIDWMKERDKKYSVAMPVITAWMLTYLCGETQYESYFREGGHYFEKWVRETLKGNVKVGRGEFPAFEIKEP

Activity

Optimum temperaturenot recorded
Optimum pHnot recorded
Familypetase_like

Structure

Source ESMFold prediction
Mean pLDDT82.3
Residues320
Cα RMSD to IsPETase7.36 Å

Active site

Catalytic triadSer152 · His250 · Asp220
Ser OG → His NE22.88 Å
His ND1 → Asp OD3.13 Å
Oxyanion donor 1153 (2.92 Å)
Oxyanion donor 280 (4.51 Å)
Cleft width24.47 Å
Cleft depth3.46 Å
Cleft residues84

Aromatic clamp: PHE113 · PHE190 · PHE231 · TRP115 · TRP253 · TRP80 · TYR104 · TYR183 · TYR229

Measured activity

ParameterValueSubstrateEvidenceSource
ordinal activity PET nanoparticle measured PMID 39551294 · 10.1016/j.ijbiomac.2024.137732
below HGMP01; not ranked against the other three. Assay: 0.5 mg/mL PET nanoparticles in 200 uL, 50 mM sodium phosphate (pH 6-8) or glycine-NaOH (pH 9-11), 25-45 degC, 24 h.

Related in PANTS

Lineage

No recorded parent or derived variants.

Nearest metagenomic candidates

No candidate in the catalogue names this enzyme as its nearest match.

Identifiers and cross-references

Human gut PET hydrolase, measured. Deposit id GUT_GENOME244370_00064 (the paper's HGMP05 is HGMP08 in the supplementary). 87 homologues in UHGP-100. DLH domain: yes. PMID 39551294.