########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

Kutbu-PETase

Kutzneria buriramensis · 288 aa · PAZy-measured

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 288 aa

catalytic triad  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MQPQQKARRWFTRSSAVLAVVLALAAGGLAATAAPAYADQVGQAPTAANITGDGSFATASAPITNQTGFGGGTVYYPTAAGTYPVVAVVPGFVSTWSQISWLGPRVASWGFVVVGADTTSGFDSPSQRADELLAALNWAVNSAPAAVRGKVDGTRRGVAGW162SMGGGGTLEALAKDTTGTVKAGVPLAPWDIGQDFSKVTKPVFIVGAQN210DTIAPPAQHAVPFYNAAAGPKSYLELAGAD240HFFPTTANPTVSRAMVSWLKRFVSSDDRFTPFTCGFAGAAVSAFRSTAC

Activity

Optimum temperaturenot recorded
Optimum pHnot recorded
Familypetase_like

Structure

Source Experimental, PDB 8YTW
Resolution2.65 Å
Residues247
Cα RMSD to IsPETase1.13 Å

Active site

Catalytic triadSer162 · His240 · Asp210
Ser OG → His NE21.80 Å
His ND1 → Asp OD3.45 Å
Oxyanion donor 1163 (4.00 Å)
Oxyanion donor 292 (4.17 Å)
Cleft width20.25 Å
Cleft depth4.81 Å
Cleft residues73

Aromatic clamp: PHE122 · PHE222 · PHE241 · PHE242 · PHE92 · TRP161 · TRP189 · TRP96

Measured activity

ParameterValueSubstrateEvidenceSource
product release 703.5418919984596 uM PET film measured 10.1126/science.adp5637
product release 703.5 +/- 27.5 uM (5 replicates)
tm 88.25 degC measured 10.1126/science.adp5637
melting temperature 88.25 degC

Related in PANTS

Lineage

No recorded parent or derived variants.

Nearest metagenomic candidates

No candidate in the catalogue names this enzyme as its nearest match.

Identifiers and cross-references

Library entry 1630 (WP_116180173.1) in the Science 2025 PET depolymerase landscape. Product release 704 +/- 27.5 uM, classed ACTIVE against its own replicate noise (active above 2 SD, inactive at or below 1 SD). Source: Landscape profiling of PET depolymerases using a natural sequence cluster framework, Science 2025 (doi:10.1126/science.adp5637), Data S3.