########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

MHETase

Piscinibacter sakaiensis · 603 aa · UniProt

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 603 aa

catalytic triad  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MQTTVTTMLLASVALAACAGGGSTPLPLPQQQPPQQEPPPPPVPLASRAACEALKDGNGDMVWPNAATVVEVAAWRDAAPATASAAALPEHCEVSGAIAKRTGIDGYPYEIKFRLRMPAEWNGRFFMEGGSGTNGSLSAATGSIGGGQIASALSRNFATIATDGGHDNAVNDNPDALGTVAFGLDPQARLDMGYNSYDQVTQAGKAAVARFYGRAADKSYFIGC225SEGGREGMMLSQRFPSHYDGIVAGAPGYQLPKAGISGAWTTQSLAPAAVGLDAQGVPLINKSFSDADLHLLSQAILGTCDALDGLADGIVDNYRACQAAFDPATAANPANGQALQCVGAKTADCLSPVQVTAIKRAMAGPVNSAGTPLYNRWAWDAGMSGLSGTTYNQGWRSWWLGSFNSSANNAQRVSGFSARSWLVDFATPPEPMPMTQVAARMMKFDFDIDPLKIWATSGQFTQSSMDWHGATSTDLAAFRDRGGKMILYHGMS492DAAFSALDTADYYERLGAAMPGAAGFARLFLVPGMN528HCSGGPGTDRFDMLTPLVAWVERGEAPDQISAWSGTPGYFGVAARTRPLCPYPQIARYKGSGDINTEANFACAAPP

Activity

Optimum temperaturenot recorded
Optimum pHnot recorded
Familymhetase_like

Structure

Source Experimental, PDB 6QGA
Resolution2.1 Å
Residues558
Cα RMSD to IsPETase21.39 Å

Active site

Catalytic triadSer225 · His528 · Asp492
Ser OG → His NE22.77 Å
His ND1 → Asp OD3.06 Å
Oxyanion donor 1226 (3.11 Å)
Oxyanion donor 2132 (5.74 Å)
Cleft width24.28 Å
Cleft depth1.94 Å
Cleft residues102

Aromatic clamp: PHE221 · PHE415 · PHE424 · PHE495 · TRP376 · TRP394 · TRP397 · TRP398 · TRP420 · TYR194 · TYR252 · TYR373 · TYR487

Measured activity

No measurement rows. The enzyme is in the reference set on the strength of its curation source rather than a value extracted into this database.

Related in PANTS

Lineage

No recorded parent or derived variants.

Nearest metagenomic candidates

No candidate in the catalogue names this enzyme as its nearest match.

Identifiers and cross-references

Ideonella/Piscinibacter sakaiensis. Tannase/feruloyl esterase group with a lid domain, NOT the PETase family: a PETase-seeded profile search never reaches it (spec section 2, point 5). 603 aa.