########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

Micpa-PETase

Micromonospora pattaloongensis · 294 aa · PAZy-measured

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 294 aa

catalytic triad  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MQRHETIPRPSHRRPRGLHRLTAIAVAAAMALTTLGVAAPPASATERGLAPTAANITGDGSYGVVSATITGASGFGGGVVYYPNATERFPVVAISPGYTERWSSFAWLGRRLASWGFVVVGIETNSLFDQPNSRGTQLLRALDWASSSAPAAVRDRVDATRQGVSGH168SMGGGGTLSAMDQRPSVRAGVPLAPWHTTTSWPRVTNPVMILGGQN214DGIAPVSSHAIPMYTGVASGEKAYVELAGAG245HNFPNSANPIVSRAAVSWFKRFLDDDTRFAPFACDFGGASISQFRSTCPV

Activity

Optimum temperaturenot recorded
Optimum pHnot recorded
Familypetase_like

Structure

Source Experimental, PDB 8YTU
Resolution1.34 Å
Residues250
Cα RMSD to IsPETase1.12 Å

Active site

Catalytic triadSer168 · His245 · Asp214
Ser OG → His NE22.88 Å
His ND1 → Asp OD3.16 Å
Oxyanion donor 1169 (3.09 Å)
Oxyanion donor 298 (5.21 Å)
Cleft width25.43 Å
Cleft depth4.33 Å
Cleft residues82

Aromatic clamp: PHE105 · PHE128 · PHE247 · TRP102 · TRP193 · TYR227 · TYR98

Measured activity

ParameterValueSubstrateEvidenceSource
product release 1506.159546083895 uM PET film measured 10.1126/science.adp5637
product release 1506 +/- 339 uM (5 replicates)
tm 68.44 degC measured 10.1126/science.adp5637
melting temperature 68.44 degC

Related in PANTS

Lineage

No recorded parent or derived variants.

Nearest metagenomic candidates

No candidate in the catalogue names this enzyme as its nearest match.

Identifiers and cross-references

Library entry 1428 (SDZ16714.1) in the Science 2025 PET depolymerase landscape. Product release 1.51e+03 +/- 339 uM, classed ACTIVE against its own replicate noise (active above 2 SD, inactive at or below 1 SD). Source: Landscape profiling of PET depolymerases using a natural sequence cluster framework, Science 2025 (doi:10.1126/science.adp5637), Data S3.