TfCut2
Thermobifida fusca · 301 aa · UniProt
Structure, superposed on IsPETase
Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.
Overlay another
Sequence 301 aa
catalytic triad · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.
MAVMTPRRERSSLLSRALQVTAAAATALVTAVSLAAPAHAANPYERGPNPTDALLEASSGPFSVSEENVSRLSASGFGGGTIYYPRENNTYGAVAISPGYTGTEASIAWLGERIASHGFVVITIDTITTLDQPDSRAEQLNAALNHMINRASSTVRSRIDSSRLAVMGH170SMGGGGTLRLASQRPDLKAAIPLTPWHLNKNWSSVTVPTLIIGADL216DTIAPVATHAKPFYNSLPSSISKAYLELDGAT248HFAPNIPNKIIGKYSVAWLKRFVDNDTRYTQFLCPGPRDGLFGEVEEYRSTCPF
Activity
| Optimum temperature | 65.0 °C |
| As published | Optimum temperature is 65 degrees Celsius (PubMed:15638529, PubMed:31690819, PubMed:32269349). UniProt also records 25-50 (PubMed:24728714), 55 (PubMed:23604968) and 60 (PubMed:20816933); none states a substrate. Rule 2: 65 carries three independent publications, the previously stored 55 carried one. |
| Optimum pH | 8.0 |
| Family | cutinase |
Structure
| Source | Experimental, PDB 4CG1 |
| Resolution | 1.4 Å |
| Residues | 262 |
| Cα RMSD to IsPETase | 0.97 Å |
Active site
| Catalytic triad | Ser130 · His208 · Asp176 |
| Ser OG → His NE2 | 2.77 Å |
| His ND1 → Asp OD | 3.03 Å |
| Oxyanion donor 1 | 131 (3.09 Å) |
| Oxyanion donor 2 | 60 (5.31 Å) |
| Cleft width | 22.43 Å |
| Cleft depth | 4.26 Å |
| Cleft residues | 84 |
Aromatic clamp: PHE188 · PHE209 · TRP155 · TYR189 · TYR60
Measured activity
| Parameter | Value | Substrate | Evidence | Source |
|---|---|---|---|---|
| catalytic activity | — | PET | measured | PMID 25545638 · PMID 31690819 · PMID 32269349 |
| (ethylene terephthalate)(n) + H2O = (ethylene terephthalate)(n-1) + 4-[(2-hydroxyethoxy)carbonyl]benzoate + H(+) | ||||
| km | 89.0 uM | pNP-butanoate (at 50 degrees Celsius and pH 8) | measured | PMID 23604968 |
| ph opt | 8.0 pH | — | measured | PMID 15638529 · PMID 20816933 · PMID 23604968 |
| Optimum pH is 8 (PubMed:23604968). Optimum pH is 6.0-6.5 (PubMed:15638529). Optimum pH is 7.5 (PubMed:20816933). | ||||
| topt | 65.0 degC | — | measured | PMID 15638529 · PMID 20816933 · PMID 23604968 · PMID 24728714 · PMID 31690819 · PMID 32269349 |
| Optimum temperature is 65 degrees Celsius (PubMed:15638529, PubMed:31690819, PubMed:32269349). UniProt also records 25-50 (PubMed:24728714), 55 (PubMed:23604968) and 60 (PubMed:20816933); none states a substrate. Rule 2: 65 carries three independent publications, the previously stored 55 carried one. | ||||
Related in PANTS
Lineage
No recorded parent or derived variants.
Nearest metagenomic candidates
1 candidate in the catalogue have this as their nearest characterised enzyme.
Identifiers and cross-references
Structure
Sequence
Thermobifida fusca cutinase 2. Thermophilic, industrial lineage. 301 aa.