########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

BhrPETase

293 aa · UniProt

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 293 aa

catalytic triad  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MQVVLGRVRSAGLLAALLALAAWALVWASPSAEAQSNPYQRGPNPTRSALTTDGPFSVATYSVSRLSVSGFGGGVIYYPTGTTLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVIVINTNSRLDFPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGH165SMGGGATLRISEQIPTLKAGVPLTPWHTDKTFNTPVPQLIVGAEA210DTVAPVSQHAIPFYQNLPSTTPKVYVELDNAT242HFAPNSPNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALSDFRSNNRHCQ

Activity

Optimum temperaturenot recorded
Optimum pHnot recorded
Familypetase_like

Structure

Source AlphaFold model, A0A2H5Z9R5
Mean pLDDT92.0
Residues293
Cα RMSD to IsPETase1.51 Å

Active site

Catalytic triadSer165 · His242 · Asp210
Ser OG → His NE22.88 Å
His ND1 → Asp OD3.13 Å
Oxyanion donor 1166 (2.95 Å)
Oxyanion donor 295 (4.52 Å)
Cleft width17.03 Å
Cleft depth4.44 Å
Cleft residues83

Aromatic clamp: PHE127 · PHE222 · PHE243 · TRP190 · TYR95

Measured activity

No measurement rows. The enzyme is in the reference set on the strength of its curation source rather than a value extracted into this database.

Related in PANTS

Lineage

Variants built on this enzyme:
TurboPETase

Nearest metagenomic candidates

No candidate in the catalogue names this enzyme as its nearest match.

Identifiers and cross-references

Bacterium HR29 PET hydrolase, 293 aa. Added as a wild type because it is TurboPETase's parent, and a variant can only be derived from a parent that lives in WILD_TYPES. It is also a PAZy-measured positive in its own right (PAZy:17), so it duplicates that row: the same already holds for IsPETase, LCC and Cut190, and is harmless because evaluation splits by 30% cluster, which keeps identical sequences on the same side. NO LIVE UNIPROTKB ENTRY: A0A2H5Z9R5, the accession PAZy still records, is inactive (DEMERGED to A0ACD6B9U1), and A0ACD6B9U1 is itself DELETED as 'not part of a reference proteome'. The sequence therefore comes from UniParc, which never deletes, and is confirmed three ways: it is byte-identical to PAZy:17, it carries an active EMBL WGS cross-reference (GBD22443, 'Poly(Ethylene terephthalate) hydrolase'), and all eight TurboPETase mutations match it at offset 0.