########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

TurboPETase

293 aa · engineered from BhrPETase · Cui et al. 2024, Nat. Commun. 15:1417

98.2% depolymerisation at 200 g/kg in 8 h

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 293 aa · 8 substitutions

catalytic triad   substitution against BhrPETase  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MQVVLGRVRSAGLLAALLALAAWALVWASPSAEAQSNPYQRGPNPTRSALTTDGPFSVATYSVSRLSVSGFGGGVIYYPTGTTLTFGGIAMSPGYTADASSLALLGRRLASHGFVVIVINTNSRLDFPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGH165SMGGGATLRISEQIPTLKAGVPLTPWHTDKTFNTPVPQLIVGAER210DTVAPVSQSAIPIYQNLPSTTPKVYVELKNAT242HTAPNSPNACISVYTISWMKLWVDNDTRYRQFLCNVNDPCLSDFRSNNRHCQ

Activity

Optimum temperature65.0 °C
As publishedThe primary paper (doi:10.1038/s41467-024-45662-9) runs its depolymerisation at 65 degrees Celsius and never reports an optimum for TurboPETase: it tests 50, 60 and 65 and 65 performs best of those three. The previously stored '65 to 68' interval does not appear in it, and may have been conflated with the melting temperature of 84 degrees. Stored as the operating temperature, not a measured optimum.
Optimum pHnot recorded
Familypetase_like

Structure

Source ESMFold prediction
Mean pLDDT94.2
Residues293
Cα RMSD to IsPETase1.64 Å

Active site

Catalytic triadSer165 · His242 · Asp210
Ser OG → His NE22.99 Å
His ND1 → Asp OD2.98 Å
Oxyanion donor 1166 (2.88 Å)
Oxyanion donor 295 (4.50 Å)
Cleft width8.70 Å
Cleft depth4.37 Å
Cleft residues82

Aromatic clamp: PHE127 · TRP190 · TYR95

Mutations

H218S, F222I, A209R, D238K, A251C, A281C, W104L, F243T

8 substitutions against BhrPETase. Every one was applied by a routine that refuses any substitution whose stated parent residue does not match, so a wrong position or a mature-versus-precursor numbering shift fails loudly rather than producing a plausible but wrong sequence.

Eight mutations on BhrPETase, NOT on IsPETase: the parent recorded here before curation was wrong. Grouped by what they do: substrate-binding cleft flexibility (H218S/F222I, W104L, F243T), surface charge-charge optimisation (A209R, D238K) and one engineered disulfide (A251C-A281C). All eight match BhrPETase at offset 0. doi:10.1038/s41467-024-45662-9

Reference: Cui et al. 2024, Nat. Commun. 15:1417 doi:10.1038/s41467-024-45662-9

Measured activity

ParameterValueSubstrateEvidenceSource
performance claim PET from review 10.1038/s41467-024-45662-9
98.2% depolymerisation at 200 g/kg in 8 h
topt 65.0 degC PET from review 10.1038/s41467-024-45662-9
The primary paper (doi:10.1038/s41467-024-45662-9) runs its depolymerisation at 65 degrees Celsius and never reports an optimum for TurboPETase: it tests 50, 60 and 65 and 65 performs best of those three. The previously stored '65 to 68' interval does not appear in it, and may have been conflated with the melting temperature of 84 degrees. Stored as the operating temperature, not a measured optimum.

Related in PANTS

Lineage

Engineered from BhrPETase.

Nearest metagenomic candidates

No candidate in the catalogue names this enzyme as its nearest match.

Identifiers and cross-references

Eight mutations on BhrPETase, NOT on IsPETase: the parent recorded here before curation was wrong. Grouped by what they do: substrate-binding cleft flexibility (H218S/F222I, W104L, F243T), surface charge-charge optimisation (A209R, D238K) and one engineered disulfide (A251C-A281C). All eight match BhrPETase at offset 0. doi:10.1038/s41467-024-45662-9