########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

DepoPETase

290 aa · engineered from IsPETase · Shi et al. 2023, Angew. Chem. Int. Ed.

7 mutations; melting temperature +23.3 °C, ~1407x product

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 290 aa · 7 substitutions

catalytic triad   substitution against IsPETase  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MNFPRASRLMQAAVLGGLMAVSAAATAQTNPYARGPNPTAASLEASAGPFTVRSFTVSRPSGYGAGTVYYPTNAGGTVGAIAIVPGYIARQSSIKWWGPRLASHGFVVITIDTNSTLDQPSSRSSQQMAALRQVASLNGTSSSPIYGKVDTARMGVMGW160SMGGGGSLISAANNPSLKAAAPQAPWHSSTNFSSVTVPTLIFACEN206DSIAPVNSSALPIYNSMSRNAKQFLEIKGGS237HSCANSGNSDQALIGKKGVAWMKYFMDNDTRYSTFACENPNSTRVSDFRTANCP

Activity

Optimum temperature50.0 °C
As publishedPublished as ~50 °C (applied).
Optimum pHnot recorded
Familypetase_like

Structure

Source ESMFold prediction
Mean pLDDT96.3
Residues290
Cα RMSD to IsPETase0.59 Å

Active site

Catalytic triadSer160 · His237 · Asp206
Ser OG → His NE22.97 Å
His ND1 → Asp OD2.79 Å
Oxyanion donor 1161 (2.86 Å)
Oxyanion donor 287 (4.52 Å)
Cleft width19.46 Å
Cleft depth4.27 Å
Cleft residues83

Aromatic clamp: PHE201 · TRP159 · TRP185 · TYR87

Mutations

T88I, D186H, D220N, N233K, N246D, R260Y, S290P

7 substitutions against IsPETase. Every one was applied by a routine that refuses any substitution whose stated parent residue does not match, so a wrong position or a mature-versus-precursor numbering shift fails loudly rather than producing a plausible but wrong sequence.

Seven-mutation IsPETase from flexible-loop directed evolution: Tm +23.3 C and ~1407-fold more product than wild type. All seven match at offset 0.

Reference: Shi et al. 2023, Angew. Chem. Int. Ed. doi:10.1002/anie.202218390

Measured activity

ParameterValueSubstrateEvidenceSource
performance claim PET from review 10.1002/anie.202218390
7 mutations; melting temperature +23.3 °C, ~1407x product
topt 50.0 degC PET from review 10.1002/anie.202218390
Published as ~50 °C (applied).

Related in PANTS

Lineage

Engineered from IsPETase.

Nearest metagenomic candidates

No candidate in the catalogue names this enzyme as its nearest match.

Identifiers and cross-references

Seven-mutation IsPETase from flexible-loop directed evolution: Tm +23.3 C and ~1407-fold more product than wild type. All seven match at offset 0.