########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

FAST-PETase-N212A/K233C/S282C

290 aa · engineered from IsPETase · Li et al. 2025, Int. J. Biol. Macromol.

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 290 aa · 7 substitutions

catalytic triad   substitution against IsPETase  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MNFPRASRLMQAAVLGGLMAVSAAATAQTNPYARGPNPTAASLEASAGPFTVRSFTVSRPSGYGAGTVYYPTNAGGTVGAIAIVPGYTARQSSIKWWGPRLASHGFVVITIDTNSTLDQPESRSSQQMAALRQVASLNGTSSSPIYGKVDTARMGVMGW160SMGGGGSLISAANNPSLKAAAPQAPWHSSTNFSSVTVPTLIFACEN206DSIAPVASSALPIYDSMSQNAKQFLEICGGS237HSCANSGNSNQALIGKKGVAWMKRFMDNDTRYSTFACENPNSTAVCDFRTANCS

Activity

Optimum temperaturenot recorded
Optimum pHnot recorded
Familypetase_like

Structure

Source Experimental, PDB 9LMS
Resolution1.71 Å
Residues262
Cα RMSD to IsPETase0.26 Å

Active site

Catalytic triadSer160 · His237 · Asp206
Ser OG → His NE22.65 Å
His ND1 → Asp OD3.14 Å
Oxyanion donor 1161 (3.09 Å)
Oxyanion donor 287 (4.91 Å)
Cleft width21.93 Å
Cleft depth4.34 Å
Cleft residues84

Aromatic clamp: PHE201 · TRP159 · TRP185 · TYR219 · TYR87

Mutations

S121E, D186H, N212A, R224Q, N233C, R280A, S282C

7 substitutions against IsPETase. Every one was applied by a routine that refuses any substitution whose stated parent residue does not match, so a wrong position or a mature-versus-precursor numbering shift fails loudly rather than producing a plausible but wrong sequence.

A disulfide-stabilised FAST-PETase, from PDB 9LMS at 1.71 A. Expressed against IsPETase rather than against FAST-PETase, because IsPETase is the root of this lineage and every other member is quoted the same way: it is FAST-PETase's five with N233K taken on to N233C, plus N212A and S282C. C233 and C282 form an engineered disulfide across the SAME residue pair Z1-PETase uses, reached independently by a different group. Verified by aligning 9LMS's mature chain to FAST-PETase, which differs at exactly the three positions its deposit title names.

Reference: Li et al. 2025, Int. J. Biol. Macromol. doi:10.1016/j.ijbiomac.2025.145862

Measured activity

No measurement rows. The enzyme is in the reference set on the strength of its curation source rather than a value extracted into this database.

Related in PANTS

Lineage

Engineered from IsPETase.

Nearest metagenomic candidates

No candidate in the catalogue names this enzyme as its nearest match.

Identifiers and cross-references

A disulfide-stabilised FAST-PETase, from PDB 9LMS at 1.71 A. Expressed against IsPETase rather than against FAST-PETase, because IsPETase is the root of this lineage and every other member is quoted the same way: it is FAST-PETase's five with N233K taken on to N233C, plus N212A and S282C. C233 and C282 form an engineered disulfide across the SAME residue pair Z1-PETase uses, reached independently by a different group. Verified by aligning 9LMS's mature chain to FAST-PETase, which differs at exactly the three positions its deposit title names.