########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

HGMP02

Bacteroidia: Porphyromonadaceae · 341 aa · HGMP-measured

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 341 aa

catalytic triad  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MNKYLRKSLYLLLLLLLLPTASPVQAQTIEMAQSQIDKLAKIETDSLASYADSYTYDEEYFAENEPATIYYPKNLEGKVPAVIVVHGFNCKQKFLQKIPQHLSSHGFICITYTALDQKRPFQWPPGLMAAYEILRGESMRPDSPIYDHVDLDAVALVGH160SMGGAGVLHTAMMPYPNGLRGKIKTVVGLNPYNGGPLMAEVGGGANDNLGDDLSHLDIPTMIVTGSY227DIVAFPWKSFAFYNSLRGPAKHAFLSIDRMD258HADWYFIPSEPKYPILRAILYSWLRAYLADDSEYRDYFVDRPGSSFDKYLKPLLSNTPNPLTRGGESFPPYVLSEEEDPLGTTN

Activity

Optimum temperaturenot recorded
Optimum pHnot recorded
Familypetase_like

Structure

Source ESMFold prediction
Mean pLDDT83.1
Residues341
Cα RMSD to IsPETase15.82 Å

Active site

Catalytic triadSer160 · His258 · Asp227
Ser OG → His NE22.95 Å
His ND1 → Asp OD3.24 Å
Oxyanion donor 1161 (2.85 Å)
Oxyanion donor 288 (4.59 Å)
Cleft width25.63 Å
Cleft depth3.09 Å
Cleft residues85

Aromatic clamp: PHE121 · PHE231 · PHE236 · PHE238 · PHE263 · PHE88 · PHE94 · TRP123 · TRP233 · TRP261 · TYR112 · TYR191 · TYR226 · TYR239 · TYR262

Measured activity

ParameterValueSubstrateEvidenceSource
ordinal activity PET nanoparticle measured PMID 39551294 · 10.1016/j.ijbiomac.2024.137732
below HGMP01; not ranked against the other three. Assay: 0.5 mg/mL PET nanoparticles in 200 uL, 50 mM sodium phosphate (pH 6-8) or glycine-NaOH (pH 9-11), 25-45 degC, 24 h.

Related in PANTS

Lineage

No recorded parent or derived variants.

Nearest metagenomic candidates

6 candidates in the catalogue have this as their nearest characterised enzyme.

3ca70320fa220dc11824c5b806cb2d0daf1467f5d71ad4c3f3de269e5718e287d88885a7

Superpose the top four →

Identifiers and cross-references

Human gut PET hydrolase, measured. Deposit id GUT_GENOME243637_00613 (the paper's HGMP02 is HGMP04 in the supplementary). 131 homologues in UHGP-100. DLH domain: no. PMID 39551294.