########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

HotPETase

272 aa · engineered from IsPETase · PDB-construct

21 mutations; melting temperature 82.5 °C

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 272 aa

catalytic triad  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MQTNPYARGPNPTAASLEASAGPFTVRSFTVARPVGYGAGTVYYPTNAGGTVGAIAIVPGYTATQSSINWWGPRLASHGFVVITIDTNSTLDKPESRSSQQMAALRQVASLNGTSSSPIYGKVDTARGGVMGW134SMGGGGSLISAANNPSLKAAAVMAPWHSSTNFSSVTVPTLIFACEN180DRIAPVKEYALPIYDSMSLNAKQFLEICGGS211HSCACSGNSNQALIGMKGVAWMKRFMDNDTRYSQFACENPNSTAVCDFRTANCSLEHHHHHH

Activity

Optimum temperature62.5 °C
As publishedPublished as 60 to 65 °C. Midpoint stored in the numeric column; the published interval is this text.
Optimum pHnot recorded
Familypetase_like

Structure

Source Experimental, PDB 7QVH
Resolution2.24 Å
Residues265
Cα RMSD to IsPETase0.46 Å

Active site

Catalytic triadSer160 · His237 · Asp206
Ser OG → His NE22.81 Å
His ND1 → Asp OD3.27 Å
Oxyanion donor 1161 (2.79 Å)
Oxyanion donor 287 (4.75 Å)
Cleft width17.49 Å
Cleft depth4.16 Å
Cleft residues81

Aromatic clamp: PHE201 · TRP159 · TRP185 · TYR214 · TYR87

Mutations

Sequence recovered from a deposited construct rather than derived from a mutation list.

Sequence taken from the deposited construct 7QVH: 21 substitutions against IsPETase.

Reference: Bell et al. 2022, Nat. Catal. doi:10.1038/s41929-022-00821-3

Measured activity

ParameterValueSubstrateEvidenceSource
performance claim PET from review 10.1038/s41929-022-00821-3
21 mutations; melting temperature 82.5 °C
topt 62.5 degC PET from review 10.1038/s41929-022-00821-3
Published as 60 to 65 °C. Midpoint stored in the numeric column; the published interval is this text.

Related in PANTS

Lineage

Engineered from IsPETase.

Nearest metagenomic candidates

No candidate in the catalogue names this enzyme as its nearest match.

Identifiers and cross-references

Sequence taken from the deposited construct 7QVH, not derived from a mutation list: the PDB SEQRES is what was actually expressed, crystallised and assayed. 21 substitutions vs IsPETase, matching the published 21. Mature construct, so shorter than the precursor parent.