########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

IsPETase-W159H/S238F

290 aa · engineered from IsPETase · Austin et al. 2018, PNAS

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 290 aa · 2 substitutions

catalytic triad   substitution against IsPETase  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MNFPRASRLMQAAVLGGLMAVSAAATAQTNPYARGPNPTAASLEASAGPFTVRSFTVSRPSGYGAGTVYYPTNAGGTVGAIAIVPGYTARQSSIKWWGPRLASHGFVVITIDTNSTLDQPSSRSSQQMAALRQVASLNGTSSSPIYGKVDTARMGVMGH160SMGGGGSLISAANNPSLKAAAPQAPWDSSTNFSSVTVPTLIFACEN206DSIAPVNSSALPIYDSMSRNAKQFLEINGGS237HFCANSGNSNQALIGKKGVAWMKRFMDNDTRYSTFACENPNSTRVSDFRTANCS

Activity

Optimum temperaturenot recorded
Optimum pHnot recorded
Familypetase_like

Structure

Source Experimental, PDB 6EQF
Resolution1.7 Å
Residues269
Cα RMSD to IsPETase1.27 Å

Active site

Catalytic triadSer160 · His237 · Asp206
Ser OG → His NE22.89 Å
His ND1 → Asp OD3.02 Å
Oxyanion donor 1161 (3.28 Å)
Oxyanion donor 287 (5.55 Å)
Cleft width22.09 Å
Cleft depth4.21 Å
Cleft residues82

Aromatic clamp: PHE201 · TRP159 · TRP185 · TYR219 · TYR87

Mutations

W159H, S238F

2 substitutions against IsPETase. Every one was applied by a routine that refuses any substitution whose stated parent residue does not match, so a wrong position or a mature-versus-precursor numbering shift fails loudly rather than producing a plausible but wrong sequence.

The narrowed-cleft double mutant: the experiment that showed the PETase cleft is wider than a cutinase's and that narrowing it changes activity.

Reference: Austin et al. 2018, PNAS doi:10.1073/pnas.1718804115

Measured activity

No measurement rows. The enzyme is in the reference set on the strength of its curation source rather than a value extracted into this database.

Related in PANTS

Lineage

Engineered from IsPETase.

Nearest metagenomic candidates

No candidate in the catalogue names this enzyme as its nearest match.

Identifiers and cross-references

The narrowed-cleft double mutant: the experiment that showed the PETase cleft is wider than a cutinase's and that narrowing it changes activity.