########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

LCC-A2

293 aa · engineered from LCC · Orr et al. 2024, Biotechnol. J.

LCC-ICCG plus H218Y/N248D; >90% depolymerisation at 200 g/kg in 3.3 h

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 293 aa · 6 substitutions

catalytic triad   substitution against LCC  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MDGVLWRVRTAALMAALLALAAWALVWASPSVEAQSNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDGPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGH165SMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEA210DTVAPVSQYAIPFYQNLPSTTPKVYVELCNAS242HIAPNSDNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALCDFRTNNRHCQ

Activity

Optimum temperature78.0 °C
As publishedPublished as 78 °C.
Optimum pHnot recorded
Familycutinase

Structure

Source ESMFold prediction
Mean pLDDT96.0
Residues293
Cα RMSD to IsPETase1.63 Å

Active site

Catalytic triadSer165 · His242 · Asp210
Ser OG → His NE22.93 Å
His ND1 → Asp OD2.93 Å
Oxyanion donor 1166 (2.87 Å)
Oxyanion donor 295 (4.51 Å)
Cleft width18.84 Å
Cleft depth4.36 Å
Cleft residues82

Aromatic clamp: PHE125 · PHE222 · TRP190 · TYR218 · TYR95

Mutations

F243I, D238C, S283C, Y127G, H218Y, N248D

6 substitutions against LCC. Every one was applied by a routine that refuses any substitution whose stated parent residue does not match, so a wrong position or a mature-versus-precursor numbering shift fails loudly rather than producing a plausible but wrong sequence.

LCC-ICCG plus H218Y/N248D, Topt 78 C. Built ON LCC-ICCG, not on wild-type LCC: its six substitutions are ICCG's four plus H218Y and N248D, verified as a strict superset. The display nests it under ICCG accordingly. Expressed here against WILD-TYPE LCC (all six mutations, offset 0) rather than against LCC-ICCG, because a variant can only be derived from a parent in WILD_TYPES and chaining a variant onto a variant would hide which residues were actually checked.

Reference: Orr et al. 2024, Biotechnol. J. doi:10.1002/biot.202400021

Measured activity

ParameterValueSubstrateEvidenceSource
performance claim PET from review 10.1002/biot.202400021
LCC-ICCG plus H218Y/N248D; >90% depolymerisation at 200 g/kg in 3.3 h
topt 78.0 degC PET from review 10.1002/biot.202400021
Published as 78 °C.

Related in PANTS

Lineage

Engineered from LCC.

Nearest metagenomic candidates

No candidate in the catalogue names this enzyme as its nearest match.

Identifiers and cross-references

LCC-ICCG plus H218Y/N248D, Topt 78 C. Built ON LCC-ICCG, not on wild-type LCC: its six substitutions are ICCG's four plus H218Y and N248D, verified as a strict superset. The display nests it under ICCG accordingly. Expressed here against WILD-TYPE LCC (all six mutations, offset 0) rather than against LCC-ICCG, because a variant can only be derived from a parent in WILD_TYPES and chaining a variant onto a variant would hide which residues were actually checked.