########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

LCC

Unknown prokaryotic organism · 293 aa · UniProt

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 293 aa

catalytic triad  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MDGVLWRVRTAALMAALLALAAWALVWASPSVEAQSNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDYPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGH165SMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEA210DTVAPVSQHAIPFYQNLPSTTPKVYVELDNAS242HFAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALSDFRTNNRHCQ

Activity

Optimum temperature70.0 °C
As publishedOn PET the optimum is SUPERIOR TO 70 degrees Celsius (PubMed:22194294); 70 is stored as a lower bound, not a measured optimum. The previously stored 50 degrees is the optimum on pNP-butanoate (PubMed:22194294, PubMed:24593046), a model ester rather than PET. Rule 1: prefer the PET substrate.
Optimum pH8.5
Familycutinase

Structure

Source Experimental, PDB 4EB0
Resolution1.5 Å
Residues258
Cα RMSD to IsPETase1.54 Å

Active site

Catalytic triadSer165 · His242 · Asp210
Ser OG → His NE22.45 Å
His ND1 → Asp OD2.75 Å
Oxyanion donor 1166 (3.26 Å)
Oxyanion donor 295 (5.32 Å)
Cleft width24.22 Å
Cleft depth4.35 Å
Cleft residues85

Aromatic clamp: PHE125 · PHE222 · PHE243 · TRP190 · TYR127 · TYR223 · TYR95

Measured activity

ParameterValueSubstrateEvidenceSource
catalytic activity PET measured PMID 22194294 · PMID 32269349
(ethylene terephthalate)(n) + H2O = (ethylene terephthalate)(n-1) + 4-[(2-hydroxyethoxy)carbonyl]benzoate + H(+)
km 0.21 mM pNP-butanoate (at 50 degrees Celsius and pH 8.0) measured PMID 24593046
km 0.22 mM pNP-butanoate (at 30 degrees Celsius and pH 8.0) measured PMID 24593046
km 0.24 mM pNP-butanoate (at 70 degrees Celsius and pH 8.0) measured PMID 24593046
ph opt 8.5 pH measured PMID 22194294
Optimum pH is 8.5 with pNP-butyrate as substrate. Shows 70% of the maximal activity at pH 7.0 and pH 9.5.
topt 70.0 degC measured PMID 22194294 · PMID 24593046 · PMID 32269349
On PET the optimum is SUPERIOR TO 70 degrees Celsius (PubMed:22194294); 70 is stored as a lower bound, not a measured optimum. The previously stored 50 degrees is the optimum on pNP-butanoate (PubMed:22194294, PubMed:24593046), a model ester rather than PET. Rule 1: prefer the PET substrate.

Related in PANTS

Lineage

Variants built on this enzyme:
LCC-A2LCC-ICCG

Nearest metagenomic candidates

No candidate in the catalogue names this enzyme as its nearest match.

Identifiers and cross-references

Leaf-branch compost cutinase, metagenome-derived. Parent of the LCC-ICCG industrial variant. 293 aa.