########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

LCC-ICCG

293 aa · engineered from LCC · Tournier et al. 2020, Nature

~90% depolymerisation of pretreated PET in under 10 h at 200 g/kg, 72 °C

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 293 aa · 4 substitutions

catalytic triad   substitution against LCC  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MDGVLWRVRTAALMAALLALAAWALVWASPSVEAQSNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDGPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQHAIPFYQNLPSTTPKVYVELCNASHIAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALCDFRTNNRHCQ

Activity

Optimum temperature68.5 °C
As publishedOptimum temperature 68.5 degC. reported as 65-72 degC; midpoint recorded. 1.3 g PET waste in 3 days from 1.25 mg enzyme. Primary reference: Tournier et al. 2020, Nature. Value taken from a secondary review, NOT from the primary paper and NOT carrying an ECO evidence code: weaker provenance than the UniProt-extracted rows.
Optimum pHnot recorded
Familycutinase

Structure

Source Experimental, PDB 6THT
Resolution1.14 Å
Depositcatalytically inactivated
Residues258
Cα RMSD to IsPETase1.56 Å

Active site

No triad measured. Either no structure was built, or the three residues are present in sequence but not connected in space, which is the distinction the geometry stage exists to make.

Mutations

F243I, D238C, S283C, Y127G

4 substitutions against LCC. Every one was applied by a routine that refuses any substitution whose stated parent residue does not match, so a wrong position or a mature-versus-precursor numbering shift fails loudly rather than producing a plausible but wrong sequence.

STRUCTURE CAVEAT: 6THT is the CATALYTICALLY INACTIVATED form. Its title, 'quintuple variant', is ICCG's four substitutions plus S165A -- the catalytic serine replaced by alanine so the enzyme could be crystallised with substrate bound. Residue 165 in that model is ALA, which is why no triad can be measured from it: the nucleophile is not there. The other deposit from the same paper, 6THS, is the same knockout on wild-type LCC, and 7VVE carries S165A too, so no active LCC-ICCG structure appears to exist. The sequence stored here is derived from the mutation list and is the ACTIVE enzyme; only the coordinates are the inactivated form. Same trap as 7CEH and the PHL7 entry. The industrial benchmark: D238C/S283C disulfide plus F243I/Y127G. Numbering is checked against the parent by apply_mutations; if the literature counts from the mature protein the offset is reported rather than guessed at.

Reference: Tournier et al. 2020, Nature doi:10.1038/s41586-020-2149-4

Measured activity

ParameterValueSubstrateEvidenceSource
performance claim PET from review 10.1038/s41586-020-2149-4
~90% depolymerisation of pretreated PET in under 10 h at 200 g/kg, 72 °C
topt 68.5 degC PET from review 10.1038/s41586-020-2149-4
Optimum temperature 68.5 degC. reported as 65-72 degC; midpoint recorded. 1.3 g PET waste in 3 days from 1.25 mg enzyme. Primary reference: Tournier et al. 2020, Nature. Value taken from a secondary review, NOT from the primary paper and NOT carrying an ECO evidence code: weaker provenance than the UniProt-extracted rows.

Related in PANTS

Lineage

Engineered from LCC.

Nearest metagenomic candidates

No candidate in the catalogue names this enzyme as its nearest match.

Identifiers and cross-references

Structure

PDB 6THT

Activity

ESTHER family database

Internal

Parent enzyme: LCC

STRUCTURE CAVEAT: 6THT is the CATALYTICALLY INACTIVATED form. Its title, 'quintuple variant', is ICCG's four substitutions plus S165A -- the catalytic serine replaced by alanine so the enzyme could be crystallised with substrate bound. Residue 165 in that model is ALA, which is why no triad can be measured from it: the nucleophile is not there. The other deposit from the same paper, 6THS, is the same knockout on wild-type LCC, and 7VVE carries S165A too, so no active LCC-ICCG structure appears to exist. The sequence stored here is derived from the mutation list and is the ACTIVE enzyme; only the coordinates are the inactivated form. Same trap as 7CEH and the PHL7 entry. The industrial benchmark: D238C/S283C disulfide plus F243I/Y127G. Numbering is checked against the parent by apply_mutations; if the literature counts from the mature protein the offset is reported rather than guessed at.