########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

ThermoPETase

290 aa · engineered from IsPETase · Son et al. 2019, ACS Catal.

3 mutations; the thermostabilised scaffold FAST-PETase was built on

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 290 aa · 3 substitutions

catalytic triad   substitution against IsPETase  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MNFPRASRLMQAAVLGGLMAVSAAATAQTNPYARGPNPTAASLEASAGPFTVRSFTVSRPSGYGAGTVYYPTNAGGTVGAIAIVPGYTARQSSIKWWGPRLASHGFVVITIDTNSTLDQPESRSSQQMAALRQVASLNGTSSSPIYGKVDTARMGVMGW160SMGGGGSLISAANNPSLKAAAPQAPWHSSTNFSSVTVPTLIFACEN206DSIAPVNSSALPIYDSMSRNAKQFLEINGGS237HSCANSGNSNQALIGKKGVAWMKRFMDNDTRYSTFACENPNSTAVSDFRTANCS

Activity

Optimum temperature50.0 °C
As publishedOptimum temperature 50 degC. thermostabilised IsPETase scaffold that FAST-PETase was built on. Primary reference: Son et al. 2019, ACS Catal.. Value taken from a secondary review, NOT from the primary paper and NOT carrying an ECO evidence code: weaker provenance than the UniProt-extracted rows.
Optimum pHnot recorded
Familypetase_like

Structure

Source ESMFold prediction
Mean pLDDT96.2
Residues290
Cα RMSD to IsPETase0.56 Å

Active site

Catalytic triadSer160 · His237 · Asp206
Ser OG → His NE22.96 Å
His ND1 → Asp OD2.79 Å
Oxyanion donor 1161 (2.85 Å)
Oxyanion donor 287 (4.52 Å)
Cleft width19.48 Å
Cleft depth4.28 Å
Cleft residues82

Aromatic clamp: PHE201 · TRP159 · TRP185 · TYR87

Mutations

S121E, D186H, R280A

3 substitutions against IsPETase. Every one was applied by a routine that refuses any substitution whose stated parent residue does not match, so a wrong position or a mature-versus-precursor numbering shift fails loudly rather than producing a plausible but wrong sequence.

Thermostabilised IsPETase, the scaffold FAST-PETase was built on.

Reference: Son et al. 2019, ACS Catal. doi:10.1021/acscatal.9b00568

Measured activity

ParameterValueSubstrateEvidenceSource
performance claim PET from review 10.1021/acscatal.9b00568
3 mutations; the thermostabilised scaffold FAST-PETase was built on
topt 50.0 degC PET from review 10.1021/acscatal.9b00568
Optimum temperature 50 degC. thermostabilised IsPETase scaffold that FAST-PETase was built on. Primary reference: Son et al. 2019, ACS Catal.. Value taken from a secondary review, NOT from the primary paper and NOT carrying an ECO evidence code: weaker provenance than the UniProt-extracted rows.

Related in PANTS

Lineage

Engineered from IsPETase.

Nearest metagenomic candidates

No candidate in the catalogue names this enzyme as its nearest match.

Identifiers and cross-references

Thermostabilised IsPETase, the scaffold FAST-PETase was built on.