########     ###    ##    ## ########  ######  
##     ##   ## ##   ###   ##    ##    ##    ## 
##     ##  ##   ##  ####  ##    ##    ##       
########  ##     ## ## ## ##    ##     ######  
##        ######### ##  ####    ##          ## 
##        ##     ## ##   ###    ##    ##    ## 
##        ##     ## ##    ##    ##     ######  

PETase ANnotation and Triage System

Nature's solution to a human-made health problem

Z1-PETase

290 aa · engineered from IsPETase · J. Hazard. Mater. 2023

13 mutations, two engineered disulfides; 20x soluble expression yield

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

Overlay another

Sequence 290 aa · 13 substitutions

catalytic triad   substitution against IsPETase  · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MNFPRASRLMQAAVLGGLMAVSAAATAQTNPYARGPDPTAASLEASAGPFTVRSFTVSRPSGYGAGTVYYPTNAGGTVGAIAIVPGYTARQSSIKWWGPRLASHGFVVITIDTNSTLDQPESRSSQQMAALEQVASLNGTSSSPIYGKVDTARMGVMGW160SMGGGGSLISACNNPSLKAAVVQAPWHSSTNFSCVTVPTLIFACEN206DSIAPVNSSALPIYDSMSENAKQFLEICGGS237HSCANTGNSDQALIGKKGVAWMKRFMDNDTRYSTFACENPNSTRVCDFRTANCS

Activity

Optimum temperature30.0 °C
As publishedPublished as 30 °C.
Optimum pHnot recorded
Familypetase_like

Structure

Source Experimental, PDB 8H5K
Resolution1.2 Å
Residues260
Cα RMSD to IsPETase0.39 Å

Active site

Catalytic triadSer160 · His237 · Asp206
Ser OG → His NE23.88 Å
His ND1 → Asp OD3.08 Å
Oxyanion donor 1161 (2.57 Å)
Oxyanion donor 287 (3.09 Å)
Cleft width19.65 Å
Cleft depth4.12 Å
Cleft residues81

Aromatic clamp: PHE201 · TRP159 · TRP185 · TYR87

Mutations

N37D, S121E, R132E, A171C, A180V, P181V, D186H, S193C, R224E, N233C, S242T, N246D, S282C

13 substitutions against IsPETase. Every one was applied by a routine that refuses any substitution whose stated parent residue does not match, so a wrong position or a mature-versus-precursor numbering shift fails loudly rather than producing a plausible but wrong sequence.

Thirteen mutations on IsPETase, including two engineered disulfides (A171C-S193C, N233C-S282C) and four shared with FAST-PETase (S121E/D186H/S242T/N246D). Topt 30 C. Confirmed TWICE and independently: the set applies cleanly to IsPETase at offset 0, and all 13 sites read the mutant residue in the deposited 8H5K structure, whose sequence differs from the derived one only by an SHM expression-tag scar and the signal peptide (zero mismatches in the mature region).

Reference: J. Hazard. Mater. 2023 doi:10.1016/j.jhazmat.2023.132297

Measured activity

ParameterValueSubstrateEvidenceSource
performance claim PET from review 10.1016/j.jhazmat.2023.132297
13 mutations, two engineered disulfides; 20x soluble expression yield
topt 30.0 degC PET from review 10.1016/j.jhazmat.2023.132297
Published as 30 °C.

Related in PANTS

Lineage

Engineered from IsPETase.

Nearest metagenomic candidates

No candidate in the catalogue names this enzyme as its nearest match.

Identifiers and cross-references

Thirteen mutations on IsPETase, including two engineered disulfides (A171C-S193C, N233C-S282C) and four shared with FAST-PETase (S121E/D186H/S242T/N246D). Topt 30 C. Confirmed TWICE and independently: the set applies cleanly to IsPETase at offset 0, and all 13 sites read the mutant residue in the deposited 8H5K structure, whose sequence differs from the derived one only by an SHM expression-tag scar and the signal peptide (zero mismatches in the mature region).