HGMP04

Alphaproteobacteria: Rhizobiaceae · 282 aa · HGMP-measured

Structure, superposed on IsPETase

Aligned onto IsPETase 6EQE when it was written, so anything added below overlays directly and the browser does no alignment. The catalytic triad is drawn from the residues the geometry stage measured, not from positions inferred by an alignment.

IsPETase 6EQE HGMP04 catalytic triad

Overlay another

Sequence 282 aa

catalytic triad · the same colours as the viewer above. Triad positions are labelled; hover any residue for its number. Click one to select it in both.

MRLLKKIVCPACLCLAGHLFTAHANADQFVQFESAAVKPTQFQERNARARGEAVNAVPGTPLQGYLTRPQGEGPFPAIVILHGCAGIHPSVKETWPERLASWGYVVLVVDSFSTRGIQNTCNNLLVDRVYDAYGALEFLSNYSFVDPKRIAVMGF156SAGGIATLEAVQFGGAERLMEHKFKAAVAYYPICKAANGDMAVPTLVLVGDL208DDWSPAEQCRTMMKQRSGAGSPVQLNVYKGAH240HAFDAPEFKTGFEAYGHWIEYNGIAADQSVSDVHAFLRGVFGN

Activity

Optimum temperature	not recorded
Optimum pH	not recorded
Family	petase_like

Structure

Source	ESMFold prediction
Mean pLDDT	91.2
Residues	282
Cα RMSD to IsPETase	9.49 Å

Active site

Catalytic triad	Ser156 · His240 · Asp208
Ser OG → His NE2	3.13 Å
His ND1 → Asp OD	3.36 Å
Oxyanion donor 1	157 (2.88 Å)
Oxyanion donor 2	84 (4.62 Å)
Cleft width	18.66 Å
Cleft depth	2.57 Å
Cleft residues	94

Aromatic clamp: PHE112 · PHE155 · PHE242 · PHE247 · PHE251 · TRP210 · TRP257 · TYR185 · TYR186 · TYR254 · TYR260

Measured activity

Parameter	Value	Substrate	Evidence	Source
ordinal activity	—	PET nanoparticle	measured	PMID 39551294 · 10.1016/j.ijbiomac.2024.137732
	below HGMP01; not ranked against the other three. Assay: 0.5 mg/mL PET nanoparticles in 200 uL, 50 mM sodium phosphate (pH 6-8) or glycine-NaOH (pH 9-11), 25-45 degC, 24 h.

Related in PANTS

Lineage

No recorded parent or derived variants.

Nearest metagenomic candidates

25 candidates in the catalogue have this as their nearest characterised enzyme.

f71cae5478f9 75ddf350d4e7 e8462e13c76a e7a5b1da49db 5c66a91f3b10 2e83b07b2cab da83b7447854 6eb128fdb77f bca3c3c4cafb 6df6e44c325d 2f4c000c41cc 3678bc760af9 5e3fc8d44e3e cb1b8795d217 1254e38f4a3e a3c5b86ef330 2e3a6ef0e9f2 d96f36ed1866 6ad686db7847 91949094d000 4da1ec3bcf6d 91f0d93aa64f d8f29f519930 7a6ef043c5bc 5cf065cb5a9d

Superpose the top four →

Identifiers and cross-references

Activity

ESTHER family database

Human gut PET hydrolase, measured. Deposit id GUT_GENOME171691_00743 (the paper's HGMP04 is HGMP07 in the supplementary). 1000 homologues in UHGP-100. DLH domain: yes. PMID 39551294.